PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT08870
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family Nin-like
Protein Properties Length: 164aa    MW: 19310.1 Da    PI: 9.2884
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT08870genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK85.64.4e-273079352
    RWP-RK  3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52
              ++i+l+d+++yF+lpi++A+++L+++l++LK++CRqyGI+RWPhRk+ksl
  EMT08870 30 ASITLNDIAQYFHLPIREASRTLKIGLSILKKKCRQYGIPRWPHRKLKSL 79
              689*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151919.36114102IPR003035RWP-RK domain
PfamPF020422.7E-223179IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MNADSDLNLT DADLLAPAEK QRRAHREYIA SITLNDIAQY FHLPIREASR TLKIGLSILK  60
KKCRQYGIPR WPHRKLKSLD SLIHDLEYVI DDETERDGVK QEDHMQDEKE NQDAIEALAK  120
RKRMLETEKA TIQQKPTLDL MAETKQFRQY VFKRKYRAKT LVSE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3738350.0AK373835.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3045A19.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003581531.16e-70PREDICTED: protein RKD5
TrEMBLM8B5K31e-118M8B5K3_AEGTA; Uncharacterized protein
STRINGBRADI5G18430.15e-70(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP106733142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.18e-39RWP-RK domain-containing protein